PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.003G270300.1.p
Common NameSb03g032260, SORBIDRAFT_03g032260
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 315aa    MW: 33955.5 Da    PI: 6.4434
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.003G270300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.35.6e-161966148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g W++eEde+l++ + ++G g+W+++++  g+ R++k+c++rw +yl
  Sobic.003G270300.1.p 19 KGLWSPEEDEKLYNHIIRYGVGCWSSVPKLAGLQRCGKSCRLRWINYL 66
                          678*******************************************97 PP

2Myb_DNA-binding47.93.2e-1572116147
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                           rg+++++E++ +v +++ lG++ W+ Ia++++ gRt++++k++w++ 
  Sobic.003G270300.1.p  72 RGSFSQQEEDAIVGLHEILGNR-WSQIASHLP-GRTDNEIKNFWNSC 116
                           899*******************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-231469IPR009057Homeodomain-like
PROSITE profilePS5129416.8431466IPR017930Myb domain
SuperFamilySSF466891.27E-2817113IPR009057Homeodomain-like
SMARTSM007172.2E-121868IPR001005SANT/Myb domain
PfamPF002492.2E-141966IPR001005SANT/Myb domain
CDDcd001671.88E-112266No hitNo description
PROSITE profilePS5129424.51767121IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-2570121IPR009057Homeodomain-like
SMARTSM007172.2E-1471119IPR001005SANT/Myb domain
PfamPF002491.4E-1372116IPR001005SANT/Myb domain
CDDcd001673.97E-1074114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MGRHAASGGG GGVQQKLRKG LWSPEEDEKL YNHIIRYGVG CWSSVPKLAG LQRCGKSCRL  60
RWINYLRPDL KRGSFSQQEE DAIVGLHEIL GNRWSQIASH LPGRTDNEIK NFWNSCLKKK  120
LRQRGIDPST HKPISANTAA AALEQPAASQ ERKPLSTAAA DGGFDTKHQH QQVFDPFPLT  180
DSFGGGFDAA AGAALYGHMG GGGGKQDAGA FVDYSSVLDV SENLGYGESS SNSSNWNCAP  240
EANNALDGGD APLHWASESK ATPHFAGYGG GEEQSLEEHK FLLPCHGQQE QSLPHFDFDI  300
SRGAVVGDFN LEFF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-28171215108B-MYB
1h8a_C8e-281712125128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1116122LKKKLRQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.80240.0embryo| root| shoot
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9616180.0EU961618.1 Zea mays clone 237078 myb-related protein Hv33 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002458370.10.0hypothetical protein SORBIDRAFT_03g032260
SwissprotP200271e-111MYB3_HORVU; Myb-related protein Hv33
TrEMBLC5XHL00.0C5XHL0_SORBI; Putative uncharacterized protein Sb03g032260
STRINGSb03g032260.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23273391
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.15e-74myb domain protein 86